PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn338441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 307aa    MW: 34891.1 Da    PI: 6.4039
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn338441genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.91.5e-2055100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+WT+eEd+ll ++v   G g+W+tIar+++ gRt++++k++w+++
       Achn338441  55 KGPWTPEEDKLLTEYVSINGEGRWSTIARYLP-GRTDNEIKNYWRTH 100
                      79******************************.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.72650105IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-2250103IPR009057Homeodomain-like
SuperFamilySSF466891.29E-1751106IPR009057Homeodomain-like
SMARTSM007176.1E-1954103IPR001005SANT/Myb domain
PfamPF002493.3E-1855100IPR001005SANT/Myb domain
CDDcd001673.62E-1557101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MAMNKRSAMF GLGFINCNQL LQSIHKADET EKEIWKVKEM VGMMDWGDVE QGWRKGPWTP  60
EEDKLLTEYV SINGEGRWST IARYLPGRTD NEIKNYWRTH FKKTSKPSKN QEKKKAQLLL  120
QQKQSQSQVN DTNDPISPNE GVLSNKTTTE TQAKQETVFT HPTVEDHCFP AMYQDFARWS  180
DNAIEDGLWG GLWDLDDSPG HVAIQNEASG YSCGGNTINW YNGGEGFLSK NSMDRSKLLW  240
NMTKAVQVRD ASKDGAIHSF STWSVLGTVA ERQTWYYRIP LHREEEVVAR VGCAMECDCF  300
GRLTKG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011021440.17e-45PREDICTED: transcription factor MYB48-like
TrEMBLA0A061EFJ93e-43A0A061EFJ9_THECC; Myb domain protein 121
STRINGPOPTR_0004s11460.12e-38(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.17e-20myb domain protein 79